PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00031222-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 211aa    MW: 23893 Da    PI: 9.4645
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00031222-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.2e-1879132957
                         HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   9 keqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  WALNUT_00031222-RA  79 QEQIGILEMLYKGgMRTPNAQQIEQITAQLgkygKIEGKNVFYWFQNHKARERQ 132
                         79**********99**************************************97 PP

2Wus_type_Homeobox102.92.3e-3377134765
   Wus_type_Homeobox   7 tPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         +P +eQi iLe+lyk G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
  WALNUT_00031222-RA  77 SP-QEQIGILEMLYKGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQ 134
                         55.69****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.9E-472137IPR001356Homeobox domain
CDDcd000862.59E-478134No hitNo description
SuperFamilySSF466892.19E-1078138IPR009057Homeodomain-like
PfamPF000461.3E-1579132IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-679132IPR009057Homeodomain-like
PROSITE profilePS500719.70180133IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGSSMKVHQF ARGFWPEHEP SLTLGCKRLR SLAPKLANTV DSTTTTAGVA AFDLKSFIKP  60
ESGPRSKFGS FDEKRDSPQE QIGILEMLYK GGMRTPNAQQ IEQITAQLGK YGKIEGKNVF  120
YWFQNHKARE RQKQKRSSLG LGHCPRTPVP ITTITLETRG GFERDQEVSP YKRKCRSWAS  180
ESLEEEDQSK SCTDQEGDRT LELFPLHPEG R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884316.11e-107PREDICTED: WUSCHEL-related homeobox 4
SwissprotQ6X7J94e-65WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A061FCE51e-106A0A061FCE5_THECC; WUSCHEL related homeobox 4
STRINGVIT_18s0001g10160.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.12e-66WUSCHEL related homeobox 4